DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and F9

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_113728.1 Gene:F9 / 24946 RGDID:2589 Length:462 Species:Rattus norvegicus


Alignment Length:344 Identity:97/344 - (28%)
Similarity:147/344 - (42%) Gaps:62/344 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAECVRLSSCQKDEKCTRLVSCSPLMNILRPRG----------MTQAEKDVFAHRQCGLDPNGHE 75
            :..|.......:|:|     ||.|.:..  |.|          :|:|| .||::...|   |..|
  Rat   147 ICSCTEGYQLAEDQK-----SCEPAVPF--PCGRVSVAYNSKKITRAE-TVFSNTDYG---NSTE 200

  Fly    76 LLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL----SLI--RY 134
            |:.........|.::..|.:.....|.|.   |.|||:..:.||.|:|..|...    ::|  ::
  Rat   201 LILDDITNSTILDNLTENSEPINDFTRVV---GGENAKPGQIPWQVILNGEIEAFCGGAIINEKW 262

  Fly   135 VLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRND 199
            ::|||||     |...|.:  .|..||...|    |.........|.:|..|..:.::...|.:|
  Rat   263 IVTAAHC-----LKPGDKI--EVVAGEHNID----EKEDTEQRRNVIRTIPHHQYNATINKYSHD 316

  Fly   200 IALLRLQFPVRYTKKIQPICLLDAEFP---LQDLNLQISGWDP--TKSSQTLITSTVK----ERN 255
            ||||.|..|:.....:.|||:.:.|:.   |:..:..:|||..  .|..|..|...::    :| 
  Rat   317 IALLELDKPLILNSYVTPICVANKEYTNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPLVDR- 380

  Fly   256 PADCLNRYPSFRSASQVCAGGQRKG--DTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYCY 317
             |.|| |...|...:.:...|.|:|  |:|.|.||.| |..:.|:.     ||.||.|:|:: |.
  Rat   381 -ATCL-RSTKFSIYNNMFCAGYREGGKDSCEGDSGGPHVTEVEGTS-----FLTGIISWGEE-CA 437

  Fly   318 SAGIPGVYTKIGHFSEWIK 336
            ..|..|:|||:..:..|||
  Rat   438 MKGKYGIYTKVSRYVNWIK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 15/58 (26%)
Tryp_SPc 108..338 CDD:238113 76/247 (31%)
Tryp_SPc 108..335 CDD:214473 73/244 (30%)
F9NP_113728.1 GLA 21..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 127..163 CDD:291342 3/20 (15%)
Tryp_SPc 227..455 CDD:214473 74/250 (30%)
Tryp_SPc 228..458 CDD:238113 77/252 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.