DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30323

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:175 Identity:34/175 - (19%)
Similarity:55/175 - (31%) Gaps:59/175 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 CPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSLIRYVLTAAHCVIGGYLT 148
            |.||..:..::...||...:.    ....|||. .|:...|...|:..:.||..:|.|.....:.
  Fly   122 CTELALLKLDRGVTGQRFAMM----LPEKELNS-TWLCNSLGWGRIYYVSYVYISAMCPAFSMVY 181

  Fly   149 QNDLV-------------LKSVRLGE-------STTDCITSESR--------------CPHLDVE 179
            .|.:.             :::.::.|       |...|:||.:.              |.|....
  Fly   182 DNPVTWFQDGPYSSELIQIRAQKISEYECKPDCSRCLCMTSYTGRGNMCQQDLGSPLFCDHFLYG 246

  Fly   180 VGQTTVH----QGF---------------TSSGGTYRNDIALLRL 205
            |.: .||    :||               |.||.|:...:...||
  Fly   247 VAR-RVHTCDDEGFMFYTNIYQNRKFIEDTLSGATWPKRVLCFRL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 34/175 (19%)
Tryp_SPc 108..338 CDD:238113 29/151 (19%)
Tryp_SPc 108..335 CDD:214473 29/151 (19%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 28/158 (18%)
Tryp_SPc 45..272 CDD:214473 28/155 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436680
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.