DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30286

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:266 Identity:83/266 - (31%)
Similarity:120/266 - (45%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDRGAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDLVLK 155
            ||..:|.........|.::|.|||..|.....|    :|:  |::||||||:      :.|..| 
  Fly    26 CGYMSPEALQNEEHQAHISESPWMAYLHKSGELVCGGTLVNHRFILTAAHCI------REDENL- 83

  Fly   156 SVRLGE----STTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQ 216
            :|||||    ::.||..|:...|..|.|:.....|.|::.:...:  ||.||||...|.|...|:
  Fly    84 TVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIH--DIGLLRLAKSVEYKVHIK 146

  Fly   217 PICLLDAEFPLQDL-----NLQISGW--DPTKSSQTLITS-TVKERNPADCLNRYPSFRSASQVC 273
            ||||: ....||..     .|..:||  .|::::..::.| .|...|...|...|...|...|:|
  Fly   147 PICLI-TNTTLQPKIERLHRLVATGWGRSPSEAANHILKSIRVTRVNWGVCSKTYWVDRRRDQIC 210

  Fly   274 AGGQRKGDTCAGISGSPVMGIMGSGV---DEFVFL-AGIASYGQQYCYSAGIPGVYTKIGHFSEW 334
            . ....|.:|:|.||.|    ||..:   ...:|: .||.|||...|.|   |.|:|.:....:|
  Fly   211 V-SHESGVSCSGDSGGP----MGQAIRLDGRVLFVQVGIVSYGNAECLS---PSVFTNVMEHIDW 267

  Fly   335 IKANLA 340
            |.|.|:
  Fly   268 IMAALS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 78/251 (31%)
Tryp_SPc 108..335 CDD:214473 76/248 (31%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 77/247 (31%)
Tryp_SPc 39..268 CDD:214473 76/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.