DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30187

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:278 Identity:82/278 - (29%)
Similarity:110/278 - (39%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 QTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRLSLI--------RYVLTAAHCVIGGYLTQND 151
            |.|| .....:..|..||......||..:  .||...|        |:|||||||::       |
  Fly    26 QICG-INIALKITGGHNAAFQNSVWMAAV--HNRTHFICGGTLIHKRFVLTAAHCIV-------D 80

  Fly   152 LVLKSVRLG-------ESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPV 209
            ..::||.||       ....|.||:              .||..| ....:|.|||.||:|...|
  Fly    81 QDVQSVSLGAYNKSDPADRKDVITA--------------VVHSSF-DVRASYENDIGLLKLSSDV 130

  Fly   210 RYTKKIQPICLLDAEFPLQDLNLQIS------------GWDP---TKSSQTLITSTVKERNPADC 259
            .:...|:|||::        ||..::            ||..   .|:|..|.|..:...:..:|
  Fly   131 IFNALIRPICIV--------LNKSMANHMRNMRTFKAFGWGTLRGNKTSDILQTIILNHLDREEC 187

  Fly   260 LNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMG---IMGSGVDEFVFLAGIASYGQQYCYSAGI 321
            ......:.|..|:|| |...||||.|.||.|:..   |.|.|..|..|  ||.|.|:..|..   
  Fly   188 YMELSVYPSEKQICA-GVPSGDTCGGDSGGPLTNDVFIQGIGNREVQF--GIISVGKTSCDG--- 246

  Fly   322 PGVYTKIGHFSEWIKANL 339
            .||||.:..|::|||..:
  Fly   247 QGVYTDLMSFADWIKMTI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 79/262 (30%)
Tryp_SPc 108..335 CDD:214473 76/259 (29%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 76/262 (29%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.