DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30098

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:257 Identity:78/257 - (30%)
Similarity:107/257 - (41%) Gaps:49/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VFRDR--GAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRL 159
            :||.|  |.:||  ...|||..|:.:||.    |||  |:|||||||.     ..||.:.  |||
  Fly    32 LFRIRVIGGQNA--RRTPWMAYLIRDNRFACGGSLIAYRFVLTAAHCT-----KINDNLF--VRL 87

  Fly   160 GE----STTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRN-DIALLRLQFPVRYTKKIQPIC 219
            ||    .|||..|...|       |.....|:.:..    :|| |||:|:|...|.|...|:|||
  Fly    88 GEYDSSRTTDGQTRSYR-------VVSIYRHKNYID----FRNHDIAVLKLDRQVVYDAYIRPIC 141

  Fly   220 LLDAEFPLQDL-----NLQISGWDPTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRK 279
            :| ....||.|     |..::||........:.| |::|.:.....|.|....|.|..|....:.
  Fly   142 IL-LNSGLQSLANSIQNFTLTGWGQMAHYYKMPT-TLQEMSLRRVRNEYCGVPSLSICCWNPVQY 204

  Fly   280 GDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYC--YSAGIPGVYTKIGHFSEWIKANL 339
              .|.|.||.|:..::..|........|:.:.....|  ||:     |..:..:..|:...|
  Fly   205 --ACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS-----YLDLMSYMPWLYQTL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 74/247 (30%)
Tryp_SPc 108..335 CDD:214473 73/244 (30%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 74/246 (30%)
Tryp_SPc 37..258 CDD:238113 74/249 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.