DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30091

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:248 Identity:79/248 - (31%)
Similarity:109/248 - (43%) Gaps:43/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLTQNDLVLK----SVRLGES 162
            |.:..||.. |||.|:...:..    |:|  ::|||||||:    .|..:.::|    :|.||..
  Fly    40 GVDAGELKN-PWMALIKTNDEFICGGSVITNKFVLTAAHCM----CTDEECIVKYTQLTVTLGVY 99

  Fly   163 TTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLL--DAEF 225
            .. ..|.|...||....|.:..:|..|...  .|||||||||||..:.|..:|:|:|:|  |...
  Fly   100 HL-LATGEHNHPHEIYNVERVYIHDSFAIQ--NYRNDIALLRLQKSIVYKPQIKPLCILLNDQLK 161

  Fly   226 PLQDLNLQIS--GWDPT---KSSQTLITSTVKERNPADC------LNRYPSFRSASQVCAGGQRK 279
            |..||..:.:  ||..|   |.|..|....:...:...|      ...||.|      |||....
  Fly   162 PQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMF------CAGTAVG 220

  Fly   280 GDTCAGISGSPV-MGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKI-GH 330
            .|||...||.|: :.::..|:.....| ||.|.|.:.|...   |:||.: ||
  Fly   221 RDTCKRDSGGPLYIHMLFDGIKRATQL-GIVSTGTEDCRGF---GMYTDVMGH 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 79/248 (32%)
Tryp_SPc 108..335 CDD:214473 79/248 (32%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 79/248 (32%)
Tryp_SPc 37..276 CDD:238113 79/248 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463566
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.