DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30090

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:281 Identity:90/281 - (32%)
Similarity:134/281 - (47%) Gaps:50/281 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VCCPELGDVLPNKQTCGQT--TPVFRDRGAENAELNEYPWM------VLLLYENRLSLIRYVLTA 138
            :|....|:.|  :..||.|  |..|:..|..:|.:|..|||      |.|:....|...|:||||
  Fly    16 LCSLGNGEYL--EPRCGLTANTIAFKIIGGRDAIINSNPWMAYIHSSVKLICGGTLITQRFVLTA 78

  Fly   139 AHCVIGGYLTQNDLVLKSVRLGE----STTDCITSESRCPHLDV-EVGQTTVHQGFTSSGGTYRN 198
            ||||       |:.....|||||    :|.|| .|:...|..:. :|.....|..|:.....  |
  Fly    79 AHCV-------NEGSAVKVRLGEYDDTATEDC-NSKICIPRAEEHDVDMAFRHGKFSEIKNL--N 133

  Fly   199 DIALLRLQFPVRYTKKIQPICLL--DAEFPLQDLNLQ---ISGWDPTKSSQT---LITSTVKERN 255
            |||||||...|.:...|.|||::  .::..|.| :::   .:||..|::.:|   |..:.::..|
  Fly   134 DIALLRLAKFVTFKAHISPICIILGTSKRELVD-SIEWFVATGWGETRTHRTRGVLQITQLQRYN 197

  Fly   256 PADCLNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVD-----EFVFLAGIASYGQQ 314
            .:.|:.........:|:|||  |.| |||.|.||.|:...: ..:|     :|    |:.|||.:
  Fly   198 SSQCMQALGRLVQQNQICAG--RLGSDTCNGDSGGPLFQTV-RHMDKMRPVQF----GVVSYGSR 255

  Fly   315 YCYSAGIPGVYTKIGHFSEWI 335
            .|  :|| ||||.:..:::||
  Fly   256 EC--SGI-GVYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 0/1 (0%)
Tryp_SPc 108..338 CDD:238113 82/253 (32%)
Tryp_SPc 108..335 CDD:214473 80/251 (32%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 80/254 (31%)
Tryp_SPc 40..276 CDD:238113 82/255 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.