DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30088

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:303 Identity:91/303 - (30%)
Similarity:132/303 - (43%) Gaps:85/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VYVC---CPELGD------VLPNKQTCGQT------TPVFRDRGAENAELNEYPWMVLLLYENRL 129
            :|:|   |..|.:      ::|   :||.:      |.:.|   .:.|.|...|:|..|.|.:.:
  Fly    10 IYICMCVCLVLQEQVAANFLIP---SCGVSYESNVATRIVR---GKEAMLKSAPFMAYLYYSSEI 68

  Fly   130 ----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGE----STTDCITSESRCPHLDVEVGQTT 184
                ::|  ||:|||||| :..||        .|||||    ...||.......|..:.::...|
  Fly    69 HCGGTIISSRYILTAAHC-MRPYL--------KVRLGEHDITRNPDCQGGSCSPPAEEFDIVLAT 124

  Fly   185 VHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLN---------LQISGWDPT 240
            .::.|..   ...||||||:|...:|:...||||||:        ||         .|..||..|
  Fly   125 KYKRFDR---FLANDIALLKLSRNIRFNVHIQPICLI--------LNPAAAPNVHEFQAFGWGQT 178

  Fly   241 KS--SQTLITSTVKERNPADCLNRYPSFRSAS---------QVCAGGQRKGDTCAGISGSP-VMG 293
            ::  |..::.:||        |.||.:....|         |:|.|.| ..|||:|.||.| |..
  Fly   179 ETNHSANVLQTTV--------LTRYDNRHCRSVLSMPITINQLCVGFQ-GSDTCSGDSGGPLVTK 234

  Fly   294 IMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            :...||..::.| ||.|:|...|.|   |||||.:.::..||:
  Fly   235 VNYDGVWRYLQL-GIVSFGDDKCQS---PGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/6 (33%)
Tryp_SPc 108..338 CDD:238113 82/260 (32%)
Tryp_SPc 108..335 CDD:214473 80/257 (31%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 81/263 (31%)
Tryp_SPc 45..273 CDD:238113 82/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.