DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG30087

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:262 Identity:84/262 - (32%)
Similarity:121/262 - (46%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CG---QTTPVFRDRGAENAELNEYPWMVLLLYENRLSLI---------RYVLTAAHCVIGGYLTQ 149
            ||   ::....|....:.|.:...|:||   |....||.         ||:|||||||....   
  Fly    30 CGVTYESQTAMRVVNGKEAVIRSAPFMV---YVTNNSLTHCGGSILNSRYILTAAHCVFPNL--- 88

  Fly   150 NDLVLKSVRLGEST--TDCITSESRCPHLDVEVG--QTTVHQGFTSSGGTYRNDIALLRLQFPVR 210
                  .:||||..  ||.....|.|.....|.|  :...|:.:.::  .:.||||||:|...:.
  Fly    89 ------RLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAA--NHVNDIALLKLNRSIN 145

  Fly   211 YTKKIQPICLL--DAEFPLQDLNLQISGWDPTKSS---QTLITSTVKERNPADCLNRYPSFRSAS 270
            :...|||||:|  .|..| .....|..||..||.:   ..|.|:.::..:.|.|...:.::.:.:
  Fly   146 FNVHIQPICILLNPASAP-SVATYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGN 209

  Fly   271 QVCAGGQRKGDTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEW 334
            |:|||.:.: |||||.||.| |..:...||..::.| ||.|||...|.|   |||||.:.::..|
  Fly   210 QICAGHEER-DTCAGDSGGPLVTRVDFDGVKRYLQL-GIVSYGPTDCQS---PGVYTYVPNYINW 269

  Fly   335 IK 336
            |:
  Fly   270 IR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 81/248 (33%)
Tryp_SPc 108..335 CDD:214473 79/245 (32%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 80/248 (32%)
Tryp_SPc 42..272 CDD:238113 81/250 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.