DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and F11

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_005262878.1 Gene:F11 / 2160 HGNCID:3529 Length:626 Species:Homo sapiens


Alignment Length:367 Identity:90/367 - (24%)
Similarity:132/367 - (35%) Gaps:123/367 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SCQKDEKCTRLVSC----------------------------SPLMNILRPRGMTQAEKDVFAHR 65
            :|||  .||..|.|                            || ..||..||....    :..|
Human   316 ACQK--LCTNAVRCQFFTYTPAQASCNEGNRGKCYLKLSSNGSP-TKILHGRGGISG----YTLR 373

  Fly    66 QCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL- 129
            .|.:|..          |..::     ..:..|.|..|   ||       |:||.|.|...:.. 
Human   374 LCKMDNE----------CTTKI-----KPRIVGGTASV---RG-------EWPWQVTLHTTSPTQ 413

  Fly   130 ------SLI--RYVLTAAHCVIG-----------GYLTQNDLVLKSVRLGESTTDCITSESRCPH 175
                  |:|  :::||||||..|           |.|.|:::...:...|               
Human   414 RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG--------------- 463

  Fly   176 LDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQ-DLNL-----QI 234
                |.:..:|..:..:...|  |||||:|:..|.||...:||||     |.: |.|:     .:
Human   464 ----VQEIIIHDQYKMAESGY--DIALLKLETTVNYTDSQRPICL-----PSKGDRNVIYTDCWV 517

  Fly   235 SGWDPTKSSQTLITSTVKERNP----ADCLNRYPSFRSASQVCAGGQRKG--DTCAGISGSPVMG 293
            :||...|....:..:..|.:.|    .:|..||...:...::...|.|:|  |.|.|.||.|   
Human   518 TGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGGKDACKGDSGGP--- 579

  Fly   294 IMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
             :....:|...|.||.|:|:. |.....|||||.:..:.:||
Human   580 -LSCKHNEVWHLVGITSWGEG-CAQRERPGVYTNVVEYVDWI 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 13/76 (17%)
Tryp_SPc 108..338 CDD:238113 69/260 (27%)
Tryp_SPc 108..335 CDD:214473 67/258 (26%)
F11XP_005262878.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..375 CDD:128519 14/65 (22%)
Tryp_SPc 388..619 CDD:214473 71/271 (26%)
Tryp_SPc 389..619 CDD:238113 71/270 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.