DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and F10

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:416 Identity:100/416 - (24%)
Similarity:151/416 - (36%) Gaps:122/416 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FFNQLA---ECVRLSSCQKDEKCTRLV---SCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNG-- 73
            |:|:..   :| ..|.||...||...:   :|:.|      .|......::|..:.|.|| ||  
Human    80 FWNKYKDGDQC-ETSPCQNQGKCKDGLGEYTCTCL------EGFEGKNCELFTRKLCSLD-NGDC 136

  Fly    74 ----HELLHMVYVCCPELGDVLPNKQTC------------------------------------- 97
                ||..:.|...|.....:..|.:.|                                     
Human   137 DQFCHEEQNSVVCSCARGYTLADNGKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITWK 201

  Fly    98 -------------------GQTTPVFRDR------GAENAELNEYPWMVLLLYENR--------L 129
                               .||.|...|.      |.:..:..|.||..||:.|..        |
Human   202 PYDAADLDPTENPFDLLDFNQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEGFCGGTIL 266

  Fly   130 SLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGG 194
            |.. |:||||||:   |..:.    ..||:|:..|:  ..|......:|||  ...|..||..  
Human   267 SEF-YILTAAHCL---YQAKR----FKVRVGDRNTE--QEEGGEAVHEVEV--VIKHNRFTKE-- 317

  Fly   195 TYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ----ISGWDPT--KSSQT----LITS 249
            ||..|||:|||:.|:.:...:.|.||.:.::....|..|    :||:..|  |..|:    ::..
Human   318 TYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKMLEV 382

  Fly   250 TVKERNPADCLNRYPSFRSASQVCAG-GQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQ 313
            ...:||  .|........:.:..||| ..::.|.|.|.||.|.:    :...:..|:.||.|:|:
Human   383 PYVDRN--SCKLSSSFIITQNMFCAGYDTKQEDACQGDSGGPHV----TRFKDTYFVTGIVSWGE 441

  Fly   314 QYCYSAGIPGVYTKIGHFSEWIKANL 339
            . |...|..|:|||:..|.:||..::
Human   442 G-CARKGKYGIYTKVTAFLKWIDRSM 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 14/57 (25%)
Tryp_SPc 108..338 CDD:238113 73/248 (29%)
Tryp_SPc 108..335 CDD:214473 71/245 (29%)
F10NP_000495.1 GLA 25..85 CDD:214503 2/4 (50%)
EGF_CA 86..122 CDD:238011 9/42 (21%)
FXa_inhibition 129..164 CDD:317114 10/35 (29%)
O-glycosylated at one site 183..203 0/19 (0%)
Tryp_SPc 235..464 CDD:238113 73/249 (29%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.