DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and PRSS55

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:261 Identity:74/261 - (28%)
Similarity:119/261 - (45%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDR-------GAENAELNEYPWMVLLLYENRL----SLIR--YVLTAAHCVIGGYLT 148
            ||..: :|..|       |...||:.|:||.|.:...:..    |::.  ::||||||:....|.
Human    53 CGDRS-IFEGRTRYSRITGGMEAEVGEFPWQVSIQARSEPFCGGSILNKWWILTAAHCLYSEELF 116

  Fly   149 QNDLVLKSVRLGESTTDCITSESRCPHLDV-EVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYT 212
            ..:|   ||.||   |:.:||    |.::: ||....:|:.|..:  ...||||||.|..|::..
Human   117 PEEL---SVVLG---TNDLTS----PSMEIKEVASIILHKDFKRA--NMDNDIALLLLASPIKLD 169

  Fly   213 KKIQPICLLDAEFPLQDLNLQISGWDPTKSSQTLITSTVKERNP------ADCLNRYPSFRSASQ 271
            ....||||.....|.......::||..|.::......|...:.|      .:|...:|.. :.:.
Human   170 DLKVPICLPTQPGPATWRECWVAGWGQTNAADKNSVKTDLMKAPMVIMDWEECSKMFPKL-TKNM 233

  Fly   272 VCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            :|||.:.:. |.|.|.||.|::.....|  |..:..||.|:|:. |.....||:||.:.:::.||
Human   234 LCAGYKNESYDACKGDSGGPLVCTPEPG--EKWYQVGIISWGKS-CGEKNTPGIYTSLVNYNLWI 295

  Fly   336 K 336
            :
Human   296 E 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 70/243 (29%)
Tryp_SPc 108..335 CDD:214473 68/240 (28%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 68/243 (28%)
Tryp_SPc 68..298 CDD:238113 70/245 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.