DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and try-4

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:264 Identity:62/264 - (23%)
Similarity:106/264 - (40%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ENAELNEYPWMVLLLYE--NRL--SLIR--YVLTAAHCVIGGYLT----------------QNDL 152
            :.:::..:||.|....:  |||  |:|.  :::||||    |::|                .|..
 Worm    51 QESKIKNFPWAVSFTVDGVNRLGGSIISPYHIITAAH----GFITTIGSRGNLCENKNWKKPNSS 111

  Fly   153 VLKSVRLGEST-------------TDCITSESRCPHLDV---EVGQTTVHQGFTSSGGTYRNDIA 201
            :.:|::....|             ||...::.||...||   :|....|...|.||.....:|.|
 Worm   112 IYRSIKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWA 176

  Fly   202 LLRLQFPVRYTKKIQPICLLDAEFPLQDL----NLQISGWDPT---KSSQTLITSTVKERNPADC 259
            ::.::..:.:::.::||||     |..::    :|.:.||..:   ..|..|| ..:..|...||
 Worm   177 IVEVEKRIHFSENVRPICL-----PRPNMYYTKSLAVPGWGRSYIFNESGPLI-HEIPMRIDRDC 235

  Fly   260 ----LNRYPS----FRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEF--VFLAGIASYGQQ 314
                .:|.|:    |..|:.:.........||.|.||    |.:....|.:  .||..|.|:|.:
 Worm   236 KRPWSDRLPADADDFICATSMNVSNYSAPRTCHGDSG----GGLEYRDDNYGRAFLIAITSFGTR 296

  Fly   315 YCYS 318
            .|.|
 Worm   297 GCPS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 62/264 (23%)
Tryp_SPc 108..335 CDD:214473 62/264 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 62/264 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.