DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Tpsb2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:264 Identity:73/264 - (27%)
Similarity:115/264 - (43%) Gaps:65/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRL-------SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGEST 163
            |...|..:::||.|.|.::...       |||  ::|||||||| |.::....|.  .|:|.|..
Mouse    34 GGHEASESKWPWQVSLRFKLNYWIHFCGGSLIHPQWVLTAAHCV-GPHIKSPQLF--RVQLREQY 95

  Fly   164 T---DCITSESRC---PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLD 222
            .   |.:.|.:|.   ||.            :|:.||.   |:|||.|:.||..:..:.||.|..
Mouse    96 LYYGDQLLSLNRIVVHPHY------------YTAEGGA---DVALLELEVPVNVSTHLHPISLPP 145

  Fly   223 AE--FPLQDLNLQISGWDPTKSSQTL--------ITSTVKERNPADCLNRY----------PSFR 267
            |.  || ...:..::||....:.:.|        :...:.|.:..|  .:|          |...
Mouse   146 ASETFP-PGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCD--RKYHTGLYTGDDFPIVH 207

  Fly   268 SASQVCAGGQRKGDTCAGISGSP-VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHF 331
            . ..:|||..|: |:|.|.||.| |..:.|:.:.     ||:.|:|:. |.....||:||::.::
Mouse   208 D-GMLCAGNTRR-DSCQGDSGGPLVCKVKGTWLQ-----AGVVSWGEG-CAQPNKPGIYTRVTYY 264

  Fly   332 SEWI 335
            .:||
Mouse   265 LDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 73/264 (28%)
Tryp_SPc 108..335 CDD:214473 71/262 (27%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 73/264 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.