DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CFD

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:297 Identity:66/297 - (22%)
Similarity:110/297 - (37%) Gaps:93/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VLPNKQTCGQ------TTPVFRDRGAENAELNEYPWMVLL------LYENRLSLIRYVLTAAHC- 141
            ||.....||:      ..|..|..|...||.:..|:|..:      |....|...::||:|||| 
Human    11 VLLGAAACGEEAWAWAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCL 75

  Fly   142 ----------VIGGY-LTQNDL------VLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGF 189
                      ::|.: |:|.:.      ||::|                ||.|            
Human    76 EDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAV----------------PHPD------------ 112

  Fly   190 TSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLN--------LQISGWD-------- 238
             |...|..:|:.||:|.........::|:       |.|.::        ..::||.        
Human   113 -SQPDTIDHDLLLLQLSEKATLGPAVRPL-------PWQRVDRDVAPGTLCDVAGWGIVNHAGRR 169

  Fly   239 PTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFV 303
            |......|:  .|.:|...:....:....:...:||...|: |:|.|.||.|   ::..||    
Human   170 PDSLQHVLL--PVLDRATCNRRTHHDGAITERLMCAESNRR-DSCKGDSGGP---LVCGGV---- 224

  Fly   304 FLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
             |.|:.:.|.:.|.:...||:||::..::.||.:.||
Human   225 -LEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 58/269 (22%)
Tryp_SPc 108..335 CDD:214473 56/266 (21%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 57/269 (21%)
Tryp_SPc 33..258 CDD:238113 58/271 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.