DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CTRL

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:251 Identity:78/251 - (31%)
Similarity:112/251 - (44%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ENAELNEYPWMVLLLYENRL-----SLI--RYVLTAAHCVI--GGYLTQNDLVLKSVRLGESTTD 165
            |||.|..:||.|.|...:..     |||  .:|:|||||.:  |.:.         |.|||..  
Human    38 ENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHF---------VVLGEYD-- 91

  Fly   166 CITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPL-QD 229
              .|.:..|...:.|.:...|..:.|:  |..||:.||:|..|.:||.:|.|:||..:...| :.
Human    92 --RSSNAEPLQVLSVSRAITHPSWNST--TMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEG 152

  Fly   230 LNLQISGW---------DPTKSSQ-TLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCA 284
            |....:||         .|....| .|...||.:     |...:.|..:.|.:|||| ....:|.
Human   153 LTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQ-----CRQYWGSSITDSMICAGG-AGASSCQ 211

  Fly   285 GISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            |.||.|::...|   :.:| |.||.|:|.:.| :...|.|||::..||.||...:|
Human   212 GDSGGPLVCQKG---NTWV-LIGIVSWGTKNC-NVRAPAVYTRVSKFSTWINQVIA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 77/247 (31%)
Tryp_SPc 108..335 CDD:214473 75/244 (31%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 77/247 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.