DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CTRB1

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001897.4 Gene:CTRB1 / 1504 HGNCID:2521 Length:263 Species:Homo sapiens


Alignment Length:257 Identity:67/257 - (26%)
Similarity:102/257 - (39%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 ENAELNEYPWMVLLLYENRL-----SLIR--YVLTAAHC-------VIGGYLTQ-----NDLVLK 155
            |:|....:||.|.|..:...     |||.  :|:|||||       |:.|...|     |..|||
Human    38 EDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLK 102

  Fly   156 SVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL 220
            ..::.::....|.                          |..|||.||:|..|.|:::.:..:||
Human   103 IAKVFKNPKFSIL--------------------------TVNNDITLLKLATPARFSQTVSAVCL 141

  Fly   221 --LDAEFPLQDLNLQISGWDPTKSSQTLITSTVKER-----NPADCLNRYPSFRSASQVCAGGQR 278
              .|.:||...| ...:||..||.:.......:::.     :.|:|...:....:...:|||...
Human   142 PSADDDFPAGTL-CATTGWGKTKYNANKTPDKLQQAALPLLSNAECKKSWGRRITDVMICAGASG 205

  Fly   279 KGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            . .:|.|.||.|::    ...|....|.||.|:|...| |...||||.::.....|::..||
Human   206 V-SSCMGDSGGPLV----CQKDGAWTLVGIVSWGSDTC-STSSPGVYARVTKLIPWVQKILA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 65/253 (26%)
Tryp_SPc 108..335 CDD:214473 64/250 (26%)
CTRB1NP_001897.4 Tryp_SPc 33..256 CDD:214473 64/250 (26%)
Tryp_SPc 34..259 CDD:238113 65/253 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.