DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG43742

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:236 Identity:78/236 - (33%)
Similarity:105/236 - (44%) Gaps:56/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LYENRL-----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVG 181
            ||.|..     |||  :|||||||||       .||...:|.|||:...|....  |.|:.....
  Fly    50 LYNNSEFFCGGSLIHKQYVLTAAHCV-------RDLDEVTVHLGENNRSCPIPV--CKHVLRLNA 105

  Fly   182 QTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPIC-LLDAEFPLQDL-NLQISGWDPTKSSQ 244
            :..:|..|  .|..:.||||||||:..|.:...|:||| :||.:....:. |....||..|:.. 
  Fly   106 KVILHPNF--HGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFTAYGWGKTEHG- 167

  Fly   245 TLITSTVKERNPADCLN-----RYPS---FRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDE 301
                      |.:|.|:     |.|.   :::.:.:|| |...||||...||.|::|       .
  Fly   168 ----------NISDVLSFIDLVRLPKSMCYQNINTICA-GSTSGDTCESDSGGPLIG-------N 214

  Fly   302 FV-------FLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            ||       .|.||.|||...|  :|:.||||.:..:..||
  Fly   215 FVHRGKSRDILFGITSYGDAEC--SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 78/236 (33%)
Tryp_SPc 108..335 CDD:214473 76/234 (32%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 76/234 (32%)
Tryp_SPc 35..256 CDD:238113 78/236 (33%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463588
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.