DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Klk1b9

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:254 Identity:78/254 - (30%)
Similarity:105/254 - (41%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENR------LSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDC 166
            |....|.|..||.|.:...|.      |....:|||||||    |..:|     .|.||::  :.
Mouse    27 GGFKCEKNSQPWHVAVYRYNEYICGGVLLDANWVLTAAHC----YYEEN-----KVSLGKN--NL 80

  Fly   167 ITSESRCPHLDVEVGQTTVHQGFTSS---------GGTYRNDIALLRLQFPVRYTKKIQPICLLD 222
            ...|....|.  .|.::.:|.|:..|         ...|.||:.||||..|...|..::||. |.
Mouse    81 YEEEPSAQHR--LVSKSFLHPGYNRSLHRNHIRHPEYDYSNDLMLLRLSKPADITDVVKPIA-LP 142

  Fly   223 AEFPLQDLNLQISGWDPT-----KSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQRKG-D 281
            .|.|........|||..|     ::::.|....:|.....||...:....:...:|||....| |
Mouse   143 TEEPKLGSTCLASGWGSTTPFKFQNAKDLQCVNLKLLPNEDCGKAHIEKVTDVMLCAGETDGGKD 207

  Fly   282 TCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            ||.|.||.|   ::..||     |.||.|:|...|.....||||||:..|:.|||..:|
Mouse   208 TCKGDSGGP---LICDGV-----LQGITSWGFTPCGEPKKPGVYTKLIKFTSWIKDTMA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 77/250 (31%)
Tryp_SPc 108..335 CDD:214473 74/247 (30%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 74/247 (30%)
Tryp_SPc 25..256 CDD:238113 77/250 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.