DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:235 Identity:60/235 - (25%)
Similarity:108/235 - (45%) Gaps:36/235 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 YPWMVLLLYENR----LSLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPH 175
            :||...:.::.|    .|||  |::|:||||    :..:|:....:|..|     .:.::   |:
Human   196 WPWQASMQWKGRHYCGASLISSRWLLSAAHC----FAKKNNSKDWTVNFG-----IVVNK---PY 248

  Fly   176 LDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPL-QDLNLQISGWD- 238
            :..:|.....|:.::|.|  ..:||||::|...|.:|:.|:.|||.:|:..| ::.|:.::||. 
Human   249 MTRKVQNIIFHENYSSPG--LHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSENDNVVVTGWGT 311

  Fly   239 -------PTKSSQTLITSTVKERNPADCLNRYPSFRSASQVCAGGQR-KGDTCAGISGSPVMGIM 295
                   |....:..:  .:.:....:....|..|.:.:.:|||... :.|.|...||.|:....
Human   312 LYMNGSFPVILQEDFL--KIIDNKICNASYAYSGFVTDTMLCAGFMSGEADACQNDSGGPLAYPD 374

  Fly   296 GSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            ...:   ..|.||.|:|.. |.....|||||::..:..||
Human   375 SRNI---WHLVGIVSWGDG-CGKKNKPGVYTRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 60/235 (26%)
Tryp_SPc 108..335 CDD:214473 58/233 (25%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699
Tryp_SPc 184..410 CDD:214473 58/233 (25%)
Tryp_SPc 185..413 CDD:238113 60/235 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.