DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:242 Identity:66/242 - (27%)
Similarity:101/242 - (41%) Gaps:66/242 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 RYVLTAAHCVIGG---YLTQNDL--VLKSVRLGESTTDCITSESRCPHLD--VEVGQTTV--HQG 188
            |::|||.|||..|   .|..|.:  ||...|..|...:.|.|:   |..|  .|||..|:  |.|
Mosquito    45 RWLLTAGHCVCSGVNKILRANQIQAVLGLYRRSEFGGNQIDSD---PFSDRAYEVGIRTIVPHPG 106

  Fly   189 FTSSGGTYRNDIALLRLQFPVRYTKKIQPICL---LDAEFPLQDLNLQISGWDPTKSSQTLITST 250
            :..:..:  ||||||.|...:.::..::||||   .|....::.....::||...:.::.|    
Mosquito   107 YVCNKPS--NDIALLELARRIDFSASVRPICLSSGADGSARVEGQTAVVAGWGWQQENRNL---- 165

  Fly   251 VKERNPADCLNR--YPSFR-----------------SASQVCAGGQRKG-DTCAGISGSP----- 290
               .:.||.|.|  ...||                 :.:|:|||....| |.|...||.|     
Mosquito   166 ---GDKADTLQRAVVDVFRNEECESMYRRGNRSRTIARTQLCAGKGTGGVDACWADSGGPLVTSD 227

  Fly   291 --VMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
              ::||:.:|:.               |...|.||:||::..::.||
Mosquito   228 NVLIGIVSTGIG---------------CARPGFPGIYTRVSEYASWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 66/242 (27%)
Tryp_SPc 108..335 CDD:214473 64/240 (27%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 64/240 (27%)
Tryp_SPc 12..259 CDD:238113 64/240 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.