DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP011719

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_320793.4 Gene:AgaP_AGAP011719 / 1280920 VectorBaseID:AGAP011719 Length:762 Species:Anopheles gambiae


Alignment Length:234 Identity:65/234 - (27%)
Similarity:105/234 - (44%) Gaps:47/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKS--VRLG-----ESTTDCITSESRCPHLDVEV 180
            |::||      |:||||||     ....|.:|..  :|:|     ::..|....|.:.    |::
Mosquito    53 LIWEN------YILTAAHC-----YADPDTILSPDVIRIGDLNLFDADDDEFVQERKI----VQI 102

  Fly   181 GQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL-LDAEFPLQDLNLQISGWDPT---- 240
            .:..:|     :..|...|:|||:|...|..::.:.|.|| ||...|..  .|:::||..|    
Mosquito   103 IRHPLH-----NASTVYYDLALLKLDKKVIQSEGVIPTCLWLDDSIPFS--TLEVAGWGQTGFGK 160

  Fly   241 KSSQTLITSTVKERNPADCLNRYPSFRSA---------SQVCAGGQRKGDTCAGISGSPVMGIMG 296
            :.|..|:.:.:|.....:|. :|.:.|:.         .|:||..:.. |||.|.||.|:...:.
Mosquito   161 EKSNMLLKAELKLMTNTECA-KYNNKRTQRRLGNDLADHQLCAWDEVM-DTCPGDSGGPLHYNLY 223

  Fly   297 SGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            ....:..||.|:.|:|:....|.  ||||.|:..|.:||
Mosquito   224 YKHTKIPFLVGVTSFGKACAVSQ--PGVYVKVAKFKQWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 65/234 (28%)
Tryp_SPc 108..335 CDD:214473 63/232 (27%)
AgaP_AGAP011719XP_320793.4 Tryp_SPc 19..263 CDD:238113 65/234 (28%)
Tryp_SPc 19..260 CDD:214473 63/232 (27%)
Tryp_SPc 318..537 CDD:304450
Tryp_SPc 653..>762 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.