DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CLIPA6

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_320728.3 Gene:CLIPA6 / 1280860 VectorBaseID:AGAP011789 Length:427 Species:Anopheles gambiae


Alignment Length:280 Identity:87/280 - (31%)
Similarity:117/280 - (41%) Gaps:69/280 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 FRDRGAEN--AELNEYPWMVLLLYENRL-------------SLI--RYVLTAAHCVIGGYLTQND 151
            ||..|::|  ||..|:||||.:|....:             |||  :.|||.||||.....:|  
Mosquito   161 FRITGSKNSEAEYGEFPWMVAILKTEEVLGQLRENVYTCGGSLIHRQVVLTGAHCVQNKQPSQ-- 223

  Fly   152 LVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQ 216
              || ||:||..|.  |.....||.|..|.:..||..:...|  ..||:|||.|..||...:.||
Mosquito   224 --LK-VRVGEWDTQ--TKNEIYPHQDRSVVEIVVHPDYYKGG--LHNDVALLFLNAPVEPNESIQ 281

  Fly   217 PICLLDAEFPLQDLNLQ-----ISGWD----------------------PTKSSQTLITSTVKER 254
            .:||     |.||:...     .|||.                      |....||.:.:|  ..
Mosquito   282 TVCL-----PPQDMAFNHETCFASGWGKDVFGKAGTYQVILKKIDLPVVPNDQCQTALRTT--RL 339

  Fly   255 NPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSA 319
            .|.  .|.:.||     :||||....|||.|..|||::..:.:....: :..|:.::|.. |...
Mosquito   340 GPK--FNLHKSF-----ICAGGVPGKDTCKGDGGSPLVCPIPNSPHHY-YQTGLVAWGIG-CGEN 395

  Fly   320 GIPGVYTKIGHFSEWIKANL 339
            ||||||..:..|..||..::
Mosquito   396 GIPGVYANVAKFRGWIDQHM 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 85/273 (31%)
Tryp_SPc 108..335 CDD:214473 83/270 (31%)
CLIPA6XP_320728.3 Tryp_SPc 162..411 CDD:214473 84/273 (31%)
Tryp_SPc 169..414 CDD:238113 83/269 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.