DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CLIPA2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_320727.4 Gene:CLIPA2 / 1280859 VectorBaseID:AGAP011790 Length:503 Species:Anopheles gambiae


Alignment Length:295 Identity:96/295 - (32%)
Similarity:130/295 - (44%) Gaps:55/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PELGDVLPNKQTCGQTTP---VFRDRGAEN--------------AELNEYPWMVLL--LYENRL- 129
            |...|..|......|.||   .::|.|..|              ||..|:||||.|  |.|.|. 
Mosquito   200 PNAADPPPTPALTAQFTPESFSYQDCGQLNLNGVVQRTINEDFRAEYGEFPWMVALFQLPEQRYC 264

  Fly   130 ---SLI--RYVLTAAHCVIG-GYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQG 188
               :||  :.:||.||||.. |....|.:    ||.||..... |.|...|..|  :|..:|||.
Mosquito   265 CNGALIDPKAILTTAHCVTNCGGRAANIM----VRFGEWNMSS-THEMAIPRED--IGVKSVHQH 322

  Fly   189 FTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDL-NLQISGW-----DPTKSSQTLI 247
            ...|.....|:||:|.|..||:|...|||:||..|..||:.: |:..:||     :....:|.|.
Mosquito   323 PRYSPSALLNNIAVLELAHPVQYQATIQPVCLPSANQPLRAMENMIATGWGRVMEENAPPTQILK 387

  Fly   248 TSTVKERNPADC---LNR----YPSFRSASQVCA----GGQRKGDTCAGISGSPVMGIMGSGVDE 301
            ...::...|:.|   |.|    ||....:|.||:    |.|.:  .|.|.:|:||: :...|...
Mosquito   388 RLDLQRMEPSICREALRRVRRPYPFILDSSFVCSTTNHGDQER--PCDGDAGAPVV-VELPGTTN 449

  Fly   302 FVFLAGIASYGQQYCYSAGIP-GVYTKIGHFSEWI 335
            ..:|.|:.|:|.. |:...|| .|.||:.||.|||
Mosquito   450 RYYLHGLVSWGYG-CHQKQIPYTVLTKVVHFREWI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 89/269 (33%)
Tryp_SPc 108..335 CDD:214473 87/267 (33%)
CLIPA2XP_320727.4 Tryp_SPc 244..486 CDD:238113 87/251 (35%)
Tryp_SPc 244..483 CDD:214473 85/249 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.