DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP011910

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_320619.4 Gene:AgaP_AGAP011910 / 1280754 VectorBaseID:AGAP011910 Length:408 Species:Anopheles gambiae


Alignment Length:255 Identity:73/255 - (28%)
Similarity:110/255 - (43%) Gaps:49/255 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRLSLI--------RYVLTAAHCVIGGYLTQNDLVL----KSVRLG 160
            |.|.| :||:|.|..|:.....::|        .|.||||||::  ..|.||.||    .:::.|
Mosquito   169 GVETA-VNEFPMMAALIDVKTKTVICGATIVTNSYALTAAHCLL--QRTVNDTVLLVGDHNIKTG 230

  Fly   161 ESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEF 225
               ||  ||.|:.    ..|.|...|.|||..  ...|||||:|...|::|...:.|.||     
Mosquito   231 ---TD--TSFSQV----YIVAQFMSHPGFTVR--PVANDIALVRTGRPIQYNPGVGPACL----- 279

  Fly   226 P-------LQDLNLQISGWDPTKSSQTLITSTVKER----NPADCLNRYPSFRSASQVCAGGQRK 279
            |       .:...::.:||..........|:..|.:    ...:|..|..:.....|:|.....:
Mosquito   280 PWSYTTQSFEGRTVEATGWGDLDFGGPRATALNKVQLAVIGNQECSQRLSASVPYQQLCTYTANR 344

  Fly   280 GDTCAGISGSPVMGI-MGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKAN 338
             |||.|.||.|:... :.:|:   ::..||.|:|.. |.:|. |.|.|::..:.:||..|
Mosquito   345 -DTCQGDSGGPLFFTNLANGL---LYDVGIVSFGIA-CATAN-PSVNTRVTEYLDWIMVN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 72/253 (28%)
Tryp_SPc 108..335 CDD:214473 70/250 (28%)
AgaP_AGAP011910XP_320619.4 CUB 27..146 CDD:238001
Tryp_SPc 165..395 CDD:214473 70/250 (28%)
Tryp_SPc 166..396 CDD:238113 71/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.