DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP011912

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_320615.4 Gene:AgaP_AGAP011912 / 1280750 VectorBaseID:AGAP011912 Length:408 Species:Anopheles gambiae


Alignment Length:244 Identity:64/244 - (26%)
Similarity:108/244 - (44%) Gaps:43/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LNEYPWMVLLLYENRLSLI--------RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSE 170
            :||:|.|..|:..:..|:.        .:.:|||||:.|..|:.:.|::....|...|.   ||.
Mosquito   178 VNEFPMMAGLVDSSSRSVFCGATIISDYHSITAAHCMRGRSLSASGLLVGDHNLSVGTD---TSY 239

  Fly   171 SRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLN---- 231
            |    :.:.:...|.|..:..|..  ||||||:|....:.:...:.|.||   .|.....|    
Mosquito   240 S----VLMRLASITNHPQYVVSPS--RNDIALVRTADRIAFNAAVGPACL---PFRYSTSNFAGS 295

  Fly   232 -LQISGWD------PTKSSQTLIT-STVKERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISG 288
             ::.:||.      ||.:....:: :.:.|::   |.:..|:. .||.:|.....| |||...||
Mosquito   296 IVEATGWGTMDFGAPTSNVLRKVSLNVISEQS---CQSSMPNI-LASHICTYTPGK-DTCQYDSG 355

  Fly   289 SPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKA 337
            .|::...|..    |:|.|:.:||.. |.|:. |.|.::|..:..||::
Mosquito   356 GPLLFTTGGR----VYLVGVVNYGVS-CASSK-PSVSSRITSYLSWIQS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 64/244 (26%)
Tryp_SPc 108..335 CDD:214473 62/240 (26%)
AgaP_AGAP011912XP_320615.4 CUB 55..155 CDD:238001
Tryp_SPc 169..396 CDD:214473 62/240 (26%)
Tryp_SPc 170..399 CDD:238113 64/244 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.