DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP009249

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_320028.4 Gene:AgaP_AGAP009249 / 1280205 VectorBaseID:AGAP009249 Length:776 Species:Anopheles gambiae


Alignment Length:268 Identity:72/268 - (26%)
Similarity:115/268 - (42%) Gaps:54/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PVFR---DRGAENAELNEYPWMVL-----------LLYENRLSLIRYVLTAAHCVIGG-YLTQND 151
            |||:   .:.::.:.|....|..:           |::||      ::||:|.|...| |:|   
Mosquito    18 PVFQRPHQKMSDFSHLGRIGWTGIDGTVRWNCSGTLVWEN------FILTSARCTTDGKYVT--- 73

  Fly   152 LVLKSVRLGESTTDCITSESRCPHLD-VEVGQTTVHQGFTSSGGTYR---NDIALLRLQFPVRYT 212
              :...|.|:......|.:.....|. ||:.:...|:        :|   :||||:||:..|...
Mosquito    74 --IYVARFGDLDLFNATDDQYAQQLKIVEIIRHPEHR--------HRDRYHDIALMRLERKVVLH 128

  Fly   213 KKIQPICL-LDAEFPLQDLNLQISGWDPT--KSSQTLITSTVKERNPAD--CLNRYPSFRS---- 268
            ..:.|.|| .|.|...:  ..:.:||..|  .:::|.|...|.....|:  |...|.:.|.    
Mosquito   129 DTVAPACLWTDDEIRFK--RFEATGWGDTGFAAAKTPILLKVALSPVANEQCNEHYSNLRGLRNG 191

  Fly   269 --ASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHF 331
              |:|:|||..|. |||.|.||.|:...:.....|..||.|:.|:|  ......:|||||::..:
Mosquito   192 LHANQLCAGDARM-DTCPGDSGGPLQVKLLHNTRETPFLVGVTSFG--LACGLSVPGVYTRVAPY 253

  Fly   332 SEWIKANL 339
            ..||::.|
Mosquito   254 VPWIRSVL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 68/256 (27%)
Tryp_SPc 108..335 CDD:214473 66/253 (26%)
AgaP_AGAP009249XP_320028.4 Trypsin 43..257 CDD:278516 64/237 (27%)
Tryp_SPc 46..260 CDD:238113 66/237 (28%)
Tryp_SPc 312..552 CDD:304450
Tryp_SPc 654..>751 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.