DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:274 Identity:81/274 - (29%)
Similarity:118/274 - (43%) Gaps:42/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPVFRDRGAENAELNEYPWMVLLLYENRL--------SLI--RYVLTAAHCVIGGYLTQND 151
            ||.|.......| :.|....:|||.||  |..:        |||  |::|||||||.......:|
Mosquito     1 CGVTRVQLIAYG-QPARAYAFPWMALL--ETSVSDDLPCGGSLISDRHILTAAHCVKARKRDCDD 62

  Fly   152 LV-LKSVRL--GES-TTDCITSESRC--PHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVR 210
            .: .|....  ||| ..|.....:.|  |...:.:.....|..:  |..:.|||:|::|||:|..
Mosquito    63 RIHFKDDEYDSGESEEADGAEYSASCGPPAQRIPIETIVTHPKY--SARSKRNDLAIIRLQYPAI 125

  Fly   211 YTKKIQPICL-----LDAEFPLQDLNLQISGWDPTKSSQ--TLITSTVKERNP-ADCLNRYPSF- 266
            ....:.||||     |.|..|....   ::||..|::.|  .::...:....| .||..|.... 
Mosquito   126 IGYNVIPICLPLTEQLRAYRPADSF---VTGWGLTETGQRSAVLRYAILPALPLPDCAMRIKELD 187

  Fly   267 ----RSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTK 327
                .....:||||..:...|.|.||.|:..:..|  ..|| |.|:.|:|.:.|.:...|||:..
Mosquito   188 RIIVLDDGHLCAGGNNRTAHCHGDSGGPLQYVSDS--TRFV-LQGVVSFGVKTCGTKIAPGVFAN 249

  Fly   328 IGHFSEWI--KANL 339
            :.||.:||  :||:
Mosquito   250 VTHFIDWIVQEANV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 76/260 (29%)
Tryp_SPc 108..335 CDD:214473 74/255 (29%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 74/258 (29%)
Tryp_SPc 9..257 CDD:238113 74/258 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.