DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP009121

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_319873.4 Gene:AgaP_AGAP009121 / 1280073 VectorBaseID:AGAP009121 Length:269 Species:Anopheles gambiae


Alignment Length:284 Identity:78/284 - (27%)
Similarity:120/284 - (42%) Gaps:41/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWM-----VLLLYENRL---SLIR 133
            |.:..:|...:....|.........|..|..|..:|...|:|.:     |:|:....:   |::.
Mosquito     3 LAVALLCLVAVAAAAPRSLQAKYGFPSGRVVGGIDALPGEFPSIVSIQRVILVVSTHICGGSILS 67

  Fly   134 --YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTY 196
              :|||||||:.....|.|    .::..|...| .||.::|   ..:.|..:|||..:  .||..
Mosquito    68 NFWVLTAAHCITENPATAN----FAIWAGTHNT-AITEDTR---QVISVASSTVHPDY--QGGVN 122

  Fly   197 RNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQISGWDPTKSS-QTLITSTVKERNPADCL 260
            ..|||::||..|:.:|.:|||: :|.|..........::||..|..: .||.....|...|   :
Mosquito   123 PTDIAVMRLAAPLTFTPRIQPV-VLPAPGSTPSGPATLAGWGSTGGTLPTLPNILQKVTKP---I 183

  Fly   261 NRYPSFRSA---------SQVCAGGQRKG-DTCAGISGSPVMGIM-GSGVDEFVFLAGIASYGQQ 314
            ..:...|||         :.||.|....| ..|:|.||.|:..:. |..|.     .||.|:|..
Mosquito   184 IPFEECRSAAGVDAPLGPTNVCTGPLTGGVSACSGDSGGPLYTVQNGQQVQ-----VGIVSWGWI 243

  Fly   315 YCYSAGIPGVYTKIGHFSEWIKAN 338
            .|.:.|.|.||..:.|:.:||:.|
Mosquito   244 PCGTIGFPSVYVGVSHYIDWIQNN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/6 (17%)
Tryp_SPc 108..338 CDD:238113 72/251 (29%)
Tryp_SPc 108..335 CDD:214473 70/248 (28%)
AgaP_AGAP009121XP_319873.4 Tryp_SPc 31..264 CDD:214473 71/251 (28%)
Tryp_SPc 32..267 CDD:238113 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.