DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG43336

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:292 Identity:87/292 - (29%)
Similarity:127/292 - (43%) Gaps:59/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 MVYVCCPELGDVLPNKQTCG---QTTPVFRDRGAENAELNEYPWMVLL------------LYENR 128
            :.:...|.||........||   .:..|.|.:....|.|...|||..|            |..||
  Fly     8 LTFFLLPLLGSTQFLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNR 72

  Fly   129 LSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTD----CITSESRCPH-LDVEVGQTTVHQG 188
            |     |||||||    :|.:.:||   .||||...:    |  .:|.|.: ::..|.:...|:.
  Fly    73 L-----VLTAAHC----FLDRTELV---ARLGEYDREEYEMC--HDSYCTYRIEAMVERGFRHRH 123

  Fly   189 FTSSGGTYRNDIALLRLQFPVRYTKKIQPICL---------LDAEFPLQDLNLQISGWDPTKS-- 242
            :......|  |||:|||...|:||..|:|||:         :|:..||..     :||..|:|  
  Fly   124 YNPMTMAY--DIAILRLYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTG-----TGWGKTESEG 181

  Fly   243 -SQTLITSTVKERNPADCLNRYPSFR-SASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFL 305
             |..|.|..:..::|..| .||.:.. :|:|.|||.:| .:.|.|.||.||..::..|..:....
  Fly   182 DSAKLRTVDLARKHPEVC-RRYATLSLTANQFCAGNER-SNLCNGDSGGPVGALIPYGKSKRFVQ 244

  Fly   306 AGIASYGQQYCYSAGIPGVYTKIGHFSEWIKA 337
            .||||:....|.   :..|:|.:..:.:||.|
  Fly   245 VGIASFTNTQCV---MVSVFTDVMSYVDWILA 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 0/4 (0%)
Tryp_SPc 108..338 CDD:238113 80/260 (31%)
Tryp_SPc 108..335 CDD:214473 77/256 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 78/259 (30%)
Tryp_SPc 40..271 CDD:238113 77/256 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463698
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.