DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG43110

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:268 Identity:87/268 - (32%)
Similarity:118/268 - (44%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 KQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENRL----SLIR--YVLTAAHCVIGGYLTQNDL 152
            ||.||: |||.:.....||......:|..:.....|    ::|.  :|||.|||           
  Fly    25 KQPCGK-TPVPKIISGSNASQQSAQYMAGIFNTTHLLCGGTIIHEDFVLTVAHC----------- 77

  Fly   153 VLKS-----VRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYT 212
              ||     ||||....:..|.:       :.|.:|..|..:::|  ||.|||||::|:..|.:.
  Fly    78 --KSTQTLFVRLGAYNINHPTDQ-------IRVIETIAHPQYSNS--TYANDIALVKLERSVIFN 131

  Fly   213 KKIQPICL-LDAEFPLQDLNLQISGWDPTKS---SQTLITSTVKERNPADC---LNRYPSFRSAS 270
            ..|||||: |||....|.......||..|::   |..|....|...||..|   |...|   ...
  Fly   132 LNIQPICIHLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSP---DPK 193

  Fly   271 QVCAGGQRKGDTCAGISGSPVMG---IMGSGVD-EFVFLAGIASYGQQYCYSAGIPGVYTKIGHF 331
            |:||... :||||||.||.|::.   ..|...| :|    ||.|||.:.|...|:   ||.:..:
  Fly   194 QICATTD-QGDTCAGDSGGPLISKITYQGKNFDTQF----GITSYGTRECNGVGL---YTDVSQY 250

  Fly   332 SEWIKANL 339
            |.|| ||:
  Fly   251 SGWI-ANI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 78/251 (31%)
Tryp_SPc 108..335 CDD:214473 76/248 (31%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 76/251 (30%)
Tryp_SPc 36..257 CDD:238113 79/254 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.