DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and TRY6_ANOGA

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_317175.2 Gene:TRY6_ANOGA / 1277692 VectorBaseID:AGAP008290 Length:273 Species:Anopheles gambiae


Alignment Length:264 Identity:72/264 - (27%)
Similarity:118/264 - (44%) Gaps:53/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 TTPVF----------RDRGAENAELNEYPWMVLLLYENRL----SLI--RYVLTAAHCVIGGYLT 148
            |.|.|          |..|....::::.|:.:.|.|..:.    |::  :::||||||:      
Mosquito    31 TRPAFHPNAPYLAGKRIVGGFVIDISDAPYQISLQYNGKHHCGGSILNSKWILTAAHCI------ 89

  Fly   149 QNDL---VLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVR 210
              ||   |..:||:|       :||.......:.:.:...|.|.:|.|..|  |||||.|:..:.
Mosquito    90 --DLYSEVKPTVRVG-------SSEHAAGGTVLHLLRIVPHPGHSSGGNNY--DIALLELECELT 143

  Fly   211 YTKKIQPICLLDAEFPLQDLNLQI-SGWDPTKS----SQTLITSTVKERNPADCLNRYPSFRSAS 270
            :...:||:.|.:.:.|:.:..:.| |||..|.|    :..|..:.|...|..:|...|.|:...:
Mosquito   144 FNDNVQPVQLPEQDDPIDEGTMGIVSGWGMTMSAADLNAILRATNVPTVNQQECNQAYQSYGGVA 208

  Fly   271 Q--VCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFS 332
            :  .|||.::.| .||...||.|   .:..|.     |.|:.|:..: |..||.||||.::....
Mosquito   209 EQMFCAGYKQGGTGTCRNDSGGP---FVAEGK-----LIGVVSWSHE-CALAGYPGVYARVASVR 264

  Fly   333 EWIK 336
            :||:
Mosquito   265 DWIR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 68/246 (28%)
Tryp_SPc 108..335 CDD:214473 66/243 (27%)
TRY6_ANOGAXP_317175.2 Tryp_SPc 46..267 CDD:214473 67/246 (27%)
Tryp_SPc 47..270 CDD:238113 68/248 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.