DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP008403

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_317049.4 Gene:AgaP_AGAP008403 / 1277577 VectorBaseID:AGAP008403 Length:873 Species:Anopheles gambiae


Alignment Length:236 Identity:70/236 - (29%)
Similarity:102/236 - (43%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LLYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLD-VEVGQTTVH 186
            |::||      ||||||||.    ...|:.....||||:...|..:.:.....|. ||:.:...|
Mosquito    51 LIWEN------YVLTAAHCT----ADDNNAAPDVVRLGDINLDDDSDDKYAQQLKIVEIIRHPEH 105

  Fly   187 QGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLL-DAEFPLQDLNLQISGWDPTKSSQTLITST 250
            : |:|.    .:|:|||||:..|.....:.|.||. |.|.|..  :::.:||..|..::|.|...
Mosquito   106 R-FSSR----YHDLALLRLERNVTLHDTVAPGCLWNDEEIPFP--SMEATGWGSTGFAKTPILLK 163

  Fly   251 VK----------------ERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGV 299
            |.                :|.....|..|       |:|| |..|.|||.|.||.|:...:.:..
Mosquito   164 VSLSLVPKSTCDQQYRKGDRGLRQGLQDY-------QLCA-GDIKMDTCPGDSGGPLQMKLLANA 220

  Fly   300 DEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            ....|:..:.|:| ..| ....||||.|:..:..||::.||
Mosquito   221 KMTPFIIAVTSFG-SVC-GQSTPGVYMKVSPYIPWIRSELA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 68/232 (29%)
Tryp_SPc 108..335 CDD:214473 66/229 (29%)
AgaP_AGAP008403XP_317049.4 Tryp_SPc 20..256 CDD:238113 68/231 (29%)
Tryp_SPc 20..254 CDD:214473 66/229 (29%)
Tryp_SPc 324..552 CDD:304450
CLIP 577..617 CDD:295450
Tryp_SPc 656..872 CDD:304450
Tryp_SPc 656..869 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.