DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:253 Identity:70/253 - (27%)
Similarity:112/253 - (44%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 GAENAELNEYPWMVLLLYENRL-----SLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTD 165
            |..:.|..:.|::..|:|.|..     |:|  |::|||||||....:|.    |..||:|  |.|
Mosquito    37 GGTDVEDGKAPYLAGLVYNNSATYCGGSIIAARWILTAAHCVTNVNVTN----LTVVRVG--TND 95

  Fly   166 CITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDL 230
            .....|.     .::.:...|:.:  |..|:|||:|||||:.|:::.:.::.|.|.:...|: :.
Mosquito    96 NYEGGSM-----YQIDRVIPHERY--SAITFRNDVALLRLKTPIKFEEHVEKIELNEELVPI-NA 152

  Fly   231 NLQISGW--------DPTKSSQTLITSTVKERNPADCLNRYPSFRSASQV-----CAGGQRKGDT 282
            .|.|.||        :|.:      |..:|.::..  |||.....:.|.:     |...:.....
Mosquito   153 TLTIVGWGFVGWNKENPKR------TQVIKVQHIG--LNRCRKMANGSAIYPEHLCTFSRAGHGP 209

  Fly   283 CAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANLA 340
            |.|.|||||:. .|..|       |:.|:......:.|:|.|...|.:|..||...:|
Mosquito   210 CKGDSGSPVVW-KGKQV-------GVVSWAMAGVCAIGLPDVQASIRYFYGWITKTMA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 69/249 (28%)
Tryp_SPc 108..335 CDD:214473 67/246 (27%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 69/249 (28%)
Tryp_SPc 35..254 CDD:214473 67/246 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.