DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CLIPC3

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_313589.2 Gene:CLIPC3 / 1274461 VectorBaseID:AGAP004318 Length:393 Species:Anopheles gambiae


Alignment Length:332 Identity:87/332 - (26%)
Similarity:135/332 - (40%) Gaps:90/332 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 VCCPE--------LGDVLP---NKQTCGQTTPV-------FRDRGAENAELN------------- 115
            ||||:        .|..:|   |.|:.|.:..:       ::|...|:..::             
Mosquito    72 VCCPQSQQLDSPPSGFSIPTPLNSQSRGGSERISEKKCNEYKDLTTESVAISALTLNPTLVKIDV 136

  Fly   116 -------------------EYPWMVLL---------LYENRLSLIR--YVLTAAHCVIGGYLTQN 150
                               |:|.|..:         .::...|||.  ||||||||    |....
Mosquito   137 PKCEMVVKLIVGGNVTKPGEFPHMAAIGWRQPNGGYSFDCGGSLISEYYVLTAAHC----YAESA 197

  Fly   151 DLVLKS-VRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKK 214
            |..|.| |||||.:  .:..:......:.::.:..||.....|.|.| |||||::|...|.:|..
Mosquito   198 DGTLPSIVRLGEQS--LVREDDGAEPENYDILRFIVHPDLKRSVGKY-NDIALIQLTERVIFTNF 259

  Fly   215 IQPICLLDAEFPLQDLNLQ---ISGWDPTK----SSQTLITSTVKERNPADCLNRYPSFRS---- 268
            |:|.||    :|.:.||::   .:|:..|:    .|..|....:...|...|..||...|.    
Mosquito   260 IRPACL----YPSEVLNVRTAIATGFGRTEYLGAKSDELRKVALNIYNNELCAERYRYDRHLRQG 320

  Fly   269 --ASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGH 330
              ::|:|.|....| |||.|.||.|:...:......| ::.|:.|.| |.|.|: .|.:|||:..
Mosquito   321 ILSTQMCVGDLAGGKDTCQGDSGGPLQVTVQENHCMF-YILGVTSLG-QVCGSS-TPAIYTKVHP 382

  Fly   331 FSEWIKA 337
            :.:||::
Mosquito   383 YLDWIES 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/1 (100%)
Tryp_SPc 108..338 CDD:238113 77/288 (27%)
Tryp_SPc 108..335 CDD:214473 75/284 (26%)
CLIPC3XP_313589.2 Tryp_SPc 146..390 CDD:238113 76/258 (29%)
Tryp_SPc 146..387 CDD:214473 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.