DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CLIPD6

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_312099.2 Gene:CLIPD6 / 1273147 VectorBaseID:AGAP002813 Length:484 Species:Anopheles gambiae


Alignment Length:401 Identity:110/401 - (27%)
Similarity:164/401 - (40%) Gaps:113/401 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AECVRLSSCQKDEKCTRLVSCSPLMN--ILRPRGMTQAEKDVFAHRQCG-LDPNGHELLHMVYVC 83
            |:|:  ....::..|..:.||..::|  :.|.|.....:....::..|. :.||         ||
Mosquito   112 ADCI--GPDNREGYCINIRSCPDVLNEFVQRQRDPQYVQYIRQSNAVCNYIQPN---------VC 165

  Fly    84 CPELGDVLPNKQT--------------------------------------------CGQTTPVF 104
            ||......|...|                                            ||.:| |.
Mosquito   166 CPLQKSAPPAPPTAPPTAPPTAPPTAPPPPPPAPVTQAPPAPAPSSGPAELLTPETGCGYST-VQ 229

  Fly   105 RDR--GAENAELNEYPWMVLLLYENRL---------SLI--RYVLTAAHCVIGGYLTQNDLVLKS 156
            .:|  |...||||.:|||.|:.|:|.|         |||  |:|||||||:      :.|  |.|
Mosquito   230 HNRVVGGVPAELNGWPWMALVGYKNTLGEVSFKCGGSLITKRHVLTAAHCI------RRD--LSS 286

  Fly   157 VRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLL 221
            |||||..|   ::::...|:||.|.:...|..:....|  ..|:|:|.::|.|:::..|:|||| 
Mosquito   287 VRLGEHDT---STDAETKHIDVPVVRYESHPSYDKKDG--HTDLAVLYMEFEVQFSDAIKPICL- 345

  Fly   222 DAEFPLQDLNLQ---------ISGWDPT----KSSQTLITSTVKERNPADCLNRYPSF-RSASQ- 271
                ||.:....         ::||..|    ||:..|....:......:|...|... :..|| 
Mosquito   346 ----PLSETIRSKNFIGYTPFVAGWGRTQEGGKSANVLQELQIPIIANDECRTLYDKIGKVFSQK 406

  Fly   272 ------VCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIG 329
                  :|||....| |:|.|.||.|:|.....|.:.:.:..||.|||.. |..|.:|||||::.
Mosquito   407 QFDNAVMCAGVIEGGKDSCQGDSGGPLMLPQRFGTEFYYYQVGIVSYGIG-CARAEVPGVYTRVA 470

  Fly   330 HFSEWIKANLA 340
            .|.:||:..:|
Mosquito   471 SFVDWIQQKVA 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 10/51 (20%)
Tryp_SPc 108..338 CDD:238113 87/262 (33%)
Tryp_SPc 108..335 CDD:214473 85/259 (33%)
CLIPD6XP_312099.2 CLIP 25..80 CDD:288855
CLIP 114..166 CDD:288855 11/62 (18%)
Tryp_SPc 232..476 CDD:214473 86/262 (33%)
Tryp_SPc 233..479 CDD:238113 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.