DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP000290

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_310831.5 Gene:AgaP_AGAP000290 / 1271969 VectorBaseID:AGAP000290 Length:499 Species:Anopheles gambiae


Alignment Length:445 Identity:102/445 - (22%)
Similarity:146/445 - (32%) Gaps:146/445 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 NQLAE-------CVRLSSCQ-----KDEKCTRLVSCSPLMNILRPR-----GMTQAEKDVFAH-- 64
            |.||:       ||.|:.|.     :|..|.....|.....|:.|.     ..|.|...||:.  
Mosquito    70 NSLADSDSPDCICVPLNRCNNQPTGRDGLCGAESVCCRRSQIIAPEKTTTTSTTTAPATVFSTGV 134

  Fly    65 ---------------------------------RQCGLDPN----------GHELLHMVYVCCPE 86
                                             .:...|||          .|.|.....   |.
Mosquito   135 TSTKLEPVDGLIFDSDPILPVLPASVPFQPIPLNESNYDPNVLAELSNLLLSHSLADTFE---PI 196

  Fly    87 LGDVLP-------------------------NKQTCGQ------TTPVFRDRGAENAE------- 113
            :.:.||                         |:|.||:      :...|::...:...       
Mosquito   197 VSNALPVDQPATNDSGRVEAATARPTTVGSGNEQRCGRRQHSVSSRIFFQEEDGDGISQAVAGPV 261

  Fly   114 -LNEYPWMVLL---------LYENRLSLIR--YVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDC 166
             .:|:||.|.:         :|....:|:.  .|:||||||....|..|..|   |..|:  .|.
Mosquito   262 GFSEFPWTVAIHQLIRNGSYVYHCGGALLNQSVVVTAAHCVSNNRLHPNRFV---VYAGD--WDR 321

  Fly   167 ITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYT-KKIQPICLLD---AEFPL 227
            ..::.|.||.:..|.:..||..:.|  |...||:|||....|...| ..::|:||..   .::..
Mosquito   322 RHTQERLPHQERTVSRVLVHPNYYS--GALFNDLALLFFSEPFNDTVANVEPVCLSSPSGTDYIP 384

  Fly   228 QDLNLQISGW------DPTKSSQTLITSTVKERNPADC-LNRYPSFRS-----ASQVCAGGQRKG 280
            .| |..::||      :..:|.|......:.||:..:. |...|:..|     .|.|||..... 
Mosquito   385 PD-NCFVTGWGGSPKGNRAQSIQQYSKLQLVERHRCETQLQSLPTLGSKFKLHQSFVCAATDGT- 447

  Fly   281 DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
            |.|.|..|||    .....|...:|.||.|:|.. | ..|||.|.|.:....|||
Mosquito   448 DVCQGSGGSP----YACERDGRYYLVGIVSWGVG-C-GDGIPAVLTNVTELREWI 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 13/98 (13%)
Tryp_SPc 108..338 CDD:238113 73/263 (28%)
Tryp_SPc 108..335 CDD:214473 71/261 (27%)
AgaP_AGAP000290XP_310831.5 Tryp_SPc 265..499 CDD:238113 73/247 (30%)
Tryp_SPc 265..496 CDD:214473 71/245 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.