DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CLIPB14

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_309876.4 Gene:CLIPB14 / 1271130 VectorBaseID:AGAP010833 Length:375 Species:Anopheles gambiae


Alignment Length:355 Identity:110/355 - (30%)
Similarity:156/355 - (43%) Gaps:74/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KCTRLVSCSPLMNILRPRGMTQAEKDVFAHR--------QCGLDPNGHELLHMVYVCCPELGDVL 91
            :|.|:..|..::::||        ||:|||.        |||..|:|..|     ||||    ..
Mosquito    39 RCVRVRECGYVLDLLR--------KDLFAHSDTVHLEGLQCGTRPDGGAL-----VCCP----AF 86

  Fly    92 PNKQTCGQTTPVFRDRGAENAELNEYPWMVLLLYENR---------LSLI--RYVLTAAHCVIGG 145
            .|:..||.:....|..|..:.||.|:|||.||.::.|         .||:  |:||:||||....
Mosquito    87 VNEPNCGPSVFGVRIIGGNDTELGEFPWMALLRFQARNRKIHGNCGASLVSKRFVLSAAHCFTAA 151

  Fly   146 YLTQNDLVLKSVRLGE-------STTDCITSESR----CPHLDVEVGQTTVHQGFTSSGGTYRND 199
              ......:.|||:.|       .:.||...:..    | ..|.:|.:...|..:..:.|.:.||
Mosquito   152 --KSKGWKIHSVRVAEWNFMNHRGSKDCKQVKGYDVPIC-RKDYDVARFVQHPEYRVNAGVHVND 213

  Fly   200 IALLRLQFPVRYTKKIQPICLL----DAEFPL-----QDLNLQISGWDPTKS-------SQTLIT 248
            |.|:.|...|.|...:.||||.    .|:.|.     .::....:||..|:|       |..|..
Mosquito   214 IVLIELAADVEYNVFVAPICLPVSNDTAQLPWGSSDDPEIEYTAAGWGSTESGKESTGMSYQLKQ 278

  Fly   249 STVKERNPADC--LNRYPSFRSA--SQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIA 309
            ..::..|...|  |.:.||....  ..:||||.|..|||.|.||.|:|..:| ||   .:||||.
Mosquito   279 INLRAFNKERCKKLFQVPSGVGVGLGHICAGGIRDEDTCHGDSGGPLMEAVG-GV---WYLAGIT 339

  Fly   310 SYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            |:|...|...|:|||||.|.|:..|::..:
Mosquito   340 SFGWPRCGRDGVPGVYTNISHYMGWLEREM 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 17/56 (30%)
Tryp_SPc 108..338 CDD:238113 86/271 (32%)
Tryp_SPc 108..335 CDD:214473 85/268 (32%)
CLIPB14XP_309876.4 CLIP 30..83 CDD:314844 17/56 (30%)
Tryp_SPc 101..367 CDD:238113 86/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BI1K
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.