DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CLIPA3

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_024667072.1 Gene:CLIPA3 / 1268922 VectorBaseID:AGAP012591 Length:422 Species:Anopheles gambiae


Alignment Length:333 Identity:99/333 - (29%)
Similarity:133/333 - (39%) Gaps:75/333 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TRLVSCSPLMNILRPRGMTQAEKDVFAHRQCGLDPNGHELLHMVYVCCPELGDVLPNKQTCGQTT 101
            |..|:....:||..|           |..|.||:.           ||      |.....||...
Mosquito   134 TNTVASVIALNIASP-----------ATCQSGLER-----------CC------LAGSYQCGMQY 170

  Fly   102 PVFRDR---GAENAELNEYPWMVLLL-----YENRLSLI--RYVLTAAHCVIGGYLTQNDLVLKS 156
            |...:.   .|..|...||||.|:||     |....:||  .:|||||| .|..| |.....|| 
Mosquito   171 PPIANSPAVTANQAAYGEYPWQVVLLGPGDVYVGSGALIDNLHVLTAAH-KISDY-TSGTRALK- 232

  Fly   157 VRLGE----STTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRY--TKKI 215
            |||||    |||:.:      |..:..|.:..||..||::  ..|||||:|||...|..  |..|
Mosquito   233 VRLGEWDAASTTEPL------PVQEFTVARYFVHPSFTAA--NLRNDIAILRLSGTVALGTTPTI 289

  Fly   216 QPICLLDAEFPLQDLNLQISGWDPTKSSQTLITSTVKE-----RNPADCLNRYPSFR-------- 267
            ...||....|  ......:|||...........|..||     .|.|:|.....:.|        
Mosquito   290 ATACLPVTSF--VGSRCWVSGWGKNDFVSGAFQSIPKEVDVPIVNSANCQTALRTTRLGGNFVLD 352

  Fly   268 SASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFS 332
            :.|.:||||:...|.|.|..|||::    ..::...::.|:.::|.. |.:.||||||..:..:.
Mosquito   353 TTSFLCAGGELGKDACTGDGGSPLV----CALNNRWYVVGLVAWGIG-CGANGIPGVYVNVASYI 412

  Fly   333 EWIKANLA 340
            .||.:.:|
Mosquito   413 TWITSTIA 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 9/46 (20%)
Tryp_SPc 108..338 CDD:238113 83/255 (33%)
Tryp_SPc 108..335 CDD:214473 81/252 (32%)
CLIPA3XP_024667072.1 Tryp_SPc 182..418 CDD:238113 82/253 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.