DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and Ctrl

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:270 Identity:77/270 - (28%)
Similarity:115/270 - (42%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CG--QTTPVF----RDRGAENAELNEYPWMVLLLYENRL-----SLI--RYVLTAAHCVI--GGY 146
            ||  ..||..    |....|||....:||.|.|......     |||  .:|:|||||.:  |.:
  Rat    19 CGVPAITPALSYNQRIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLIAPNWVVTAAHCKVTPGRH 83

  Fly   147 LTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRY 211
            .         |.|||..    .|.:..|...:.:.:...|..:..:  |..||:.||:|..|.||
  Rat    84 F---------VILGEYD----RSSNAEPIQVLSISKAITHPSWNPN--TMNNDLTLLKLASPARY 133

  Fly   212 TKKIQPICLLDAEFPL-QDLNLQISGW---------DPTKSSQTLI-TSTVKERNPADCLNRYPS 265
            |.::.|:||..:...| ..|....:||         .|.:..|.:: ..||.:     |...:.|
  Rat   134 TAQVSPVCLASSNEALPAGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQ-----CRQYWGS 193

  Fly   266 FRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGH 330
            ..:.|.:|||| ....:|.|.||.|::...|   :.:| |.||.|:|.:.| :...|.:||::..
  Rat   194 RITDSMICAGG-AGASSCQGDSGGPLVCQKG---NTWV-LIGIVSWGTENC-NVQAPAMYTRVSK 252

  Fly   331 FSEWIKANLA 340
            |:.||...:|
  Rat   253 FNTWINQVIA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 71/249 (29%)
Tryp_SPc 108..335 CDD:214473 69/246 (28%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 70/249 (28%)
Tryp_SPc 34..260 CDD:238113 71/251 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.