DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and LOC116411715

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031760387.1 Gene:LOC116411715 / 116411715 -ID:- Length:386 Species:Xenopus tropicalis


Alignment Length:295 Identity:81/295 - (27%)
Similarity:130/295 - (44%) Gaps:56/295 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LLHMVYVCCPELGDVLPNKQTCGQTTPVF----RDRGAENAELNEYPWMVL-----------LLY 125
            |.::...|...:|.:..|:       |:|    |..|.:|:...::||||.           |..
 Frog    15 LFNLFPECESAIGGICGNR-------PLFNKGSRIVGGQNSPPGKWPWMVSIQSPTGKEFSHLCG 72

  Fly   126 ENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRL--GESTTDCITSESRCPHLDVEVGQTTVHQG 188
            .:.|:.| :|||||||.  .:|.:.: ..||.||  |.:....:.|..:...:. ||.|...:..
 Frog    73 GSVLNEI-WVLTAAHCF--KHLQRKE-ETKSWRLVFGANNLKVLESSVQIRKIK-EVIQPKAYNP 132

  Fly   189 FTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNLQ------ISGW-----DPTKS 242
            .|.:     |||.||||..|:.:|..:||.|     ||.:..|::      |:||     :..:.
 Frog   133 TTEA-----NDITLLRLDKPIVFTDYVQPAC-----FPTEFANVEKKTDCYIAGWGVLDEESGEP 187

  Fly   243 SQTLITSTVKERNPADCLNR--YPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVF 304
            |:.|..:.|.:.:...|.::  |........:|||.::.| |:|.|.||.|:|  ..:.......
 Frog   188 SEILQEARVHQIDSKKCNSKDWYDGAIGEYNLCAGHEKGGIDSCQGDSGGPLM--CKTQKSRTYA 250

  Fly   305 LAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            :.||.|:|.. |.....|||||...:|.:||.:.:
 Frog   251 VVGITSWGSG-CARGKKPGVYTSTKYFIKWIASKV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 1/7 (14%)
Tryp_SPc 108..338 CDD:238113 74/256 (29%)
Tryp_SPc 108..335 CDD:214473 72/253 (28%)
LOC116411715XP_031760387.1 Tryp_SPc 41..280 CDD:214473 73/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.