DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and St14

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_446087.1 Gene:St14 / 114093 RGDID:69288 Length:855 Species:Rattus norvegicus


Alignment Length:266 Identity:79/266 - (29%)
Similarity:117/266 - (43%) Gaps:45/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CG--QTTPVFRDRGAENAELNEYPWMVLL--LYENRL---SLIR--YVLTAAHCVIGGYLTQNDL 152
            ||  ..|...|..|..||:..|:||.|.|  |.:..|   |||.  ::::||||.      |::.
  Rat   604 CGLRSFTKQARVVGGTNADEGEWPWQVSLHALGQGHLCGASLISPDWLVSAAHCF------QDET 662

  Fly   153 VLK-------SVRLGESTTDCITSESRCPHLDVE---VGQTTVHQGFTSSGGTYRNDIALLRLQF 207
            :.|       :..||      :..:|:.....|:   :.:...|..|...  |:..|||||.|:.
  Rat   663 IFKYSDHTMWTAFLG------LLDQSKRSASGVQEHKLKRIITHPSFNDF--TFDYDIALLELEK 719

  Fly   208 PVRYTKKIQPICLLDAE--FPLQDLNLQISGWDPTKSSQT----LITSTVKERNPADCLNRYPSF 266
            |..|:..::||||.|..  ||.... :.::||..||...|    |....::..|...|....|..
  Rat   720 PAEYSTVVRPICLPDNTHVFPAGKA-IWVTGWGHTKEGGTGALILQKGEIRVINQTTCEELLPQQ 783

  Fly   267 RSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGH 330
            .:...:|.|....| |:|.|.||.|:..:...|   .:|.||:.|:|:. |.....|||||:|..
  Rat   784 ITPRMMCVGFLSGGVDSCQGDSGGPLSSVEKDG---RIFQAGVVSWGEG-CAQRNKPGVYTRIPE 844

  Fly   331 FSEWIK 336
            ..:|||
  Rat   845 VRDWIK 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 75/253 (30%)
Tryp_SPc 108..335 CDD:214473 72/250 (29%)
St14NP_446087.1 SEA 88..178 CDD:396113
CUB 214..332 CDD:238001
CUB 340..444 CDD:238001
LDLa 454..486 CDD:238060
LDLa 492..523 CDD:238060
LDLa 525..559 CDD:238060
LDLa 567..602 CDD:238060
Tryp_SPc 615..852 CDD:238113 75/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.