DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP013252

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_003436670.1 Gene:AgaP_AGAP013252 / 11175997 VectorBaseID:AGAP013252 Length:597 Species:Anopheles gambiae


Alignment Length:299 Identity:75/299 - (25%)
Similarity:125/299 - (41%) Gaps:65/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PELGDVLP-----NKQTCGQTTPVFRDRGAENAELNEYPWMVLL----------LYENRLSLIR- 133
            |.|.|..|     |..||| .:|..  .||.::.| .:||:.|:          :....::||. 
Mosquito   302 PLLVDNSPKLRMLNFNTCG-ISPYM--TGANDSFL-AFPWIGLVEMVAPGQGKTMAVCHVTLISE 362

  Fly   134 -YVLTAAHCVIGGYLTQNDLVLKSVRLG--ESTT--DCITSESR--C--PHLDVEVGQTTVHQGF 189
             |.:..|||.      .||.:.:::|.|  :.||  |||.....  |  |...:.:.:..|...|
Mosquito   363 WYAVGPAHCF------SNDGMERTLRFGDYDKTTDKDCIERNGTLVCAPPVQILPIERVIVRPDF 421

  Fly   190 TSSGGTYRNDIALLRLQFPVRYTK-KIQPICLLDAEFPLQDLNLQISGWDPTK--------SSQT 245
            .....|  :||||:.|:.|...:: .::||||        .:.:.:..:.||.        ....
Mosquito   422 DRQAIT--DDIALIELRRPANISQPNVKPICL--------PVTVDLRSYKPTSFTLGGFPAQGNR 476

  Fly   246 LITSTVKERNPADCLNR-----YPSFRSASQVCA----GGQRKGDTCAG-ISGSPVMGIMGSGVD 300
            ::.|.....|..:|..|     ||..:|.:|:||    ....:.:.|.. :|||.:..:...|..
Mosquito   477 VVASRPTYLNSVNCQERYNAIYYPLRKSHTQICAVAEVSSTNRTEPCERMLSGSVLQTVQQLGRR 541

  Fly   301 EFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            :..||.|:.|:|.:.| .|.:|.:||.:..:.:||..|:
Mosquito   542 DRYFLQGLLSFGAREC-DATVPDIYTNVPIYLDWILYNM 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 65/268 (24%)
Tryp_SPc 108..335 CDD:214473 63/265 (24%)
AgaP_AGAP013252XP_003436670.1 Tryp_SPc 47..287 CDD:214473
Tryp_SPc 48..287 CDD:238113
Tryp_SPc 334..575 CDD:214473 60/257 (23%)
Tryp_SPc 335..575 CDD:304450 60/256 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.