DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP013221

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_003436543.1 Gene:AgaP_AGAP013221 / 11175927 VectorBaseID:AGAP013221 Length:318 Species:Anopheles gambiae


Alignment Length:327 Identity:83/327 - (25%)
Similarity:127/327 - (38%) Gaps:99/327 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HMVYVC------------CPELGDVLPNKQ-----------------TCGQTTPVFRDRGAENAE 113
            |::.:|            |.|...::.||:                 .|.....:.  .|.|.|:
Mosquito    17 HLISLCDGQTAKRISVQKCDEYRRIISNKRGVISLTLNPKPFYYQSYNCSNVVDLI--VGGEAAK 79

  Fly   114 LNEYPWMVLLLYENR------------LSLI--RYVLTAAHCVIGGYLTQNDLVLKSVRLGE--S 162
            ..|:|...||.|...            .|||  |::||||||     .:..|.|:  |||||  .
Mosquito    80 HGEFPHQALLGYPREDGSPEPYSFSCGGSLISDRFILTAAHC-----FSYGDPVI--VRLGEYDL 137

  Fly   163 TTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPL 227
            |.|..|      .||..:.:...|..:.:|...:  |:||:||...|.::|.|:|.||      .
Mosquito   138 TVDSTT------QLDFGIAEIIRHPKYRNSRSYH--DLALVRLNETVLFSKVIRPACL------W 188

  Fly   228 QDLNLQISGWDPT------KSSQTLITSTVKERNPADCLNRYPS------------FRSA---SQ 271
            .:..|.:|.:..|      :.|..|.|..:|.:     |:.:||            ||..   .|
Mosquito   189 TNPTLNVSRFVATGFGKQEEGSTDLSTKLMKVQ-----LDLFPSSDCGELFRDNRKFRDGIDEGQ 248

  Fly   272 VCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVF-LAGIASYGQQYCYSAGIPGVYTKIGHFSEW 334
            :|.|....| |||.|.||.|:..|  :.....:: :.|:.|.|.. |.......:|:|:.|:.:|
Mosquito   249 LCVGSLIGGKDTCQGDSGGPLQTI--TEPRSCIYNIVGVTSTGAA-CGVGNSKAIYSKVAHYLDW 310

  Fly   335 IK 336
            |:
Mosquito   311 IE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 2/17 (12%)
Tryp_SPc 108..338 CDD:238113 76/268 (28%)
Tryp_SPc 108..335 CDD:214473 74/265 (28%)
AgaP_AGAP013221XP_003436543.1 Tryp_SPc 72..314 CDD:238113 76/272 (28%)
Tryp_SPc 72..311 CDD:214473 74/269 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.