DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and AgaP_AGAP013089

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_003436251.1 Gene:AgaP_AGAP013089 / 11175918 VectorBaseID:AGAP013089 Length:634 Species:Anopheles gambiae


Alignment Length:290 Identity:87/290 - (30%)
Similarity:129/290 - (44%) Gaps:61/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LPNKQT--CGQTTPVF-RDRGAENAELNEYPWMVLLLYEN---------------RLSLIRYVLT 137
            ||....  ||.:.... |..|..:|:||.:|||..|.|.:               .|....:|||
Mosquito   363 LPTNDVDRCGMSNGTHTRVVGGVDAQLNAWPWMAALGYRSTSFELNAGPRFLCGGTLITTLHVLT 427

  Fly   138 AAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIAL 202
            .|||:        ...|..|||||  .|..:.:.....:|:.:.:..||:.:...  ...|||||
Mosquito   428 VAHCI--------QTALYFVRLGE--LDITSDQDGANPVDIYIQRWVVHERYDEK--KIYNDIAL 480

  Fly   203 LRLQFPVRYTKKIQPICL-LDAEFPLQDLNLQ---ISGW------DPT----KSSQTLITSTVKE 253
            :.||..|..|:.::|||| ::|:...:||...   |:||      .||    :.:|.::.     
Mosquito   481 VLLQKSVTITEAVRPICLPVEAKQRTKDLTYYAPFIAGWGAVGYNGPTAARLQEAQVVVL----- 540

  Fly   254 RNPAD-CLNRYPSFRSA-----SQVCAGGQRKG-DTCAGISGSPVM--GIMGSGVDEFVFLAGIA 309
              |.| |...|..:...     :.:|||..:.| |:|.|.||.|:|  .:..:|...:..|.|:.
Mosquito   541 --PVDQCAFNYKLYFPGQIFDDTVLCAGFPQGGKDSCQGDSGGPLMLPELSSNGQYYYYTLIGLI 603

  Fly   310 SYGQQYCYSAGIPGVYTKIGHFSEWIKANL 339
            |||.: |..||.||||.|:..:..||:|||
Mosquito   604 SYGYE-CARAGFPGVYVKVTAYLPWIEANL 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 79/267 (30%)
Tryp_SPc 108..335 CDD:214473 77/264 (29%)
AgaP_AGAP013089XP_003436251.1 CLIP 250..304 CDD:288855
Tryp_SPc 380..628 CDD:214473 78/267 (29%)
Tryp_SPc 381..631 CDD:238113 79/269 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D402896at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.