DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and LOC108648818

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_017952796.2 Gene:LOC108648818 / 108648818 -ID:- Length:928 Species:Xenopus tropicalis


Alignment Length:272 Identity:84/272 - (30%)
Similarity:122/272 - (44%) Gaps:66/272 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTP-VFRDR--GAENAELNEYPWMVLLL--YENRLSLI--RYVLTAAHCVIGGYLTQNDLVL 154
            ||:..| ...|:  |..||.|..:||...|:  |....|||  .:::|||||::     .||...
 Frog   686 CGKGGPSALEDKIVGGTNAVLGSWPWQAALVSNYLCGASLISNTWLVTAAHCIV-----TNDPNS 745

  Fly   155 KSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPIC 219
            .:||||  |....::.:|     .::.|..:|:.:||:  |...|||||:|..||.:|..||.:|
 Frog   746 YTVRLG--TLYWYSTINR-----FKLQQIIIHENYTSA--TMGYDIALLKLATPVTFTSYIQSVC 801

  Fly   220 LLDA--EFPLQDLNLQISGWD--------------------PTK--SSQTLITSTVKERNPADCL 260
            |.:|  .|| .:.:..|:||.                    .||  ||..:..||:|        
 Frog   802 LPEASSSFP-DNSSCYITGWGTLSYGGSVSNILQEAQVEIISTKLCSSSLMYGSTIK-------- 857

  Fly   261 NRYPSFRSASQVCAGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGV 324
                    .|.:|||..... |:|.|.||.|:  :..:..|...:|.||.|:|.. |..|..|||
 Frog   858 --------PSMLCAGYVNGNIDSCQGDSGGPL--VYRNSSDSSWYLVGIISFGDG-CAQAYRPGV 911

  Fly   325 YTKIGHFSEWIK 336
            |.::.:...|||
 Frog   912 YARVTYLRNWIK 923

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 80/258 (31%)
Tryp_SPc 108..335 CDD:214473 77/255 (30%)
LOC108648818XP_017952796.2 Tryp_SPc 698..925 CDD:238113 80/260 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.