DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and LOC108647852

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:308 Identity:80/308 - (25%)
Similarity:124/308 - (40%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RQCGLDP---NGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWM--VLLL 124
            :.||:.|   |.|.:..::....||.|                           .:|||  :.||
 Frog    27 KTCGIRPLVKNHHRVRRVIEGNTPEPG---------------------------SWPWMASIQLL 64

  Fly   125 YENR--------LSLIRYVLTAAHCVIGGYLTQNDLV----LKSVRLGESTTDCITSESRCPHLD 177
            |::.        |...|:|:|||||:       :||.    |..:.||......:..|::..   
 Frog    65 YKDGYGSACGGVLLSNRWVVTAAHCL-------SDLKRYRHLARIVLGARDLTQLGPETQIR--- 119

  Fly   178 VEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICLLDAEFPLQDLNL------QISG 236
             .:.|...|:.|...  |::|||||:||.:||:::..|||.||     |.:..|:      .|:|
 Frog   120 -TIKQWIQHEDFDHK--THKNDIALIRLNYPVKFSDYIQPACL-----PPKSSNVYKMDDCHIAG 176

  Fly   237 WDPTKSSQTLITSTVKE-------RNPADCLNRYPSFRSASQVCAGGQRKG-DTCAGISGSPVM- 292
            |.........:|:.::|       |...:..:.|........:|||.::.| |.|.|.||.|:| 
 Frog   177 WGLLNEKPRTVTTMLQEATVELIDRKRCNSSDWYNGGIHDDNLCAGYEQGGPDVCMGDSGGPLMC 241

  Fly   293 -----GIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWI 335
                 ||        .::.||.|:| ..|......||||.:..|.:||
 Frog   242 KRKKAGI--------YYVVGIVSWG-GLCGQPHSNGVYTSVQDFEQWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 5/21 (24%)
Tryp_SPc 108..338 CDD:238113 72/262 (27%)
Tryp_SPc 108..335 CDD:214473 70/260 (27%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 73/289 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.