DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and MASP2

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:363 Identity:102/363 - (28%)
Similarity:153/363 - (42%) Gaps:86/363 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CQKDEKCTR------LVSCSPLMNILRPR-------GMT--------QAEKDVFAHR------QC 67
            ||||....|      :|.|.|..::...|       |:|        ..|:..:..:      .|
Human   348 CQKDGSWDRPMPACSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVC 412

  Fly    68 GLD-----PNGHELLHMVYVCCPELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMVL----- 122
            ..|     ..|.:.|.   ||.|..|  |..:.|.|      |..|.:.|:..::||.||     
Human   413 EADGFWTSSKGEKSLP---VCEPVCG--LSARTTGG------RIYGGQKAKPGDFPWQVLILGGT 466

  Fly   123 -----LLYENRLSLIRYVLTAAHCVIGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQ 182
                 |||:|      :||||||.|   |..::|.....:|:|       |.:...||......:
Human   467 TAAGALLYDN------WVLTAAHAV---YEQKHDASALDIRMG-------TLKRLSPHYTQAWSE 515

  Fly   183 TT-VHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL--LDAE-FPLQDLNLQISGWDPTKS- 242
            .. :|:|:|...| :.|||||::|...|.....|.||||  .:|| |...|.....|||..|:. 
Human   516 AVFIHEGYTHDAG-FDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRG 579

  Fly   243 --SQTLITSTVKERNPADCLNRY--PSFR----SASQVCAGGQRKG-DTCAGISGSPVMGIMGSG 298
              ::.|:...:...:...|...|  |.:.    :|:.:|||.:..| |:|.|.||..:: .:.|.
Human   580 FLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALV-FLDSE 643

  Fly   299 VDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336
            .:.: |:.||.|:|...|..||..|||||:.::..||:
Human   644 TERW-FVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIE 680

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855 13/80 (16%)
Tryp_SPc 108..338 CDD:238113 78/253 (31%)
Tryp_SPc 108..335 CDD:214473 76/250 (30%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478 5/12 (42%)
Sushi 366..430 CDD:278512 10/66 (15%)
Tryp_SPc 444..679 CDD:214473 77/253 (30%)
Tryp_SPc 445..682 CDD:238113 78/255 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.