DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and CG42694

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:225 Identity:63/225 - (28%)
Similarity:100/225 - (44%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 SLI--RYVLTAAHCV-IGGYLTQNDLVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTS 191
            |||  ::||:||.|: :.|.|        .|:||      :::.::.||. ..|....:.   :.
  Fly    61 SLISKQFVLSAAQCIDVHGKL--------FVQLG------VSNATKSPHW-YTVSNVVIP---SH 107

  Fly   192 SGGTYRNDIALLRLQFPVRYTKKIQPICL------LDAEFPLQDLNLQISGW-DPTKSSQTLITS 249
            ||...:.||.||:|...|.|...:.|||:      ||....||  |...|.| ...|:.||::.|
  Fly   108 SGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQ--NFTTSAWLSKNKNPQTIVLS 170

  Fly   250 TV-KERNPADCLNRYPSFRSASQVCAGGQRKGDTCAGISGS----PVMGIMGSG-VDEFVFLAGI 308
            .: ::|    |........:..::||...::.::|...|||    |:  |.||. |.|.:|  ||
  Fly   171 QLSRDR----CKLNLSGNVTPKEICAASLQRNNSCFIDSGSALTQPI--IQGSNIVREMLF--GI 227

  Fly   309 ASY--GQQYCYSAGIPGVYTKIGHFSEWIK 336
            ..|  |:.:|..   |.:|..:.....||:
  Fly   228 RGYVNGRSWCSE---PAIYIDVAECVGWIE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 63/225 (28%)
Tryp_SPc 108..335 CDD:214473 61/222 (27%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 63/225 (28%)
Tryp_SPc 46..253 CDD:214473 61/222 (27%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.