DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18754 and LOC101732176

DIOPT Version :9

Sequence 1:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:262 Identity:81/262 - (30%)
Similarity:123/262 - (46%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 CGQTTPV-FRDRGAENAELNEYPWMVLL-------LYENRLSLIR--YVLTAAHCVIGGYLTQND 151
            ||.:|.| .|..|...|...::||.:.|       ||....|:|.  :::||||||.|  .|.:.
 Frog   267 CGLSTKVDNRIVGGTFALAGDWPWQISLMKLVGTSLYLCGGSIITPYWIVTAAHCVYG--YTSSP 329

  Fly   152 LVLKSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQ 216
            .:.| |..|..|   :::.....:|   |.:..:|..:  |..|...|||||:|:..:.::..::
 Frog   330 SIFK-VFAGSLT---LSNYYSAGYL---VDRVLIHPSY--SPNTQNYDIALLKLKTALVFSTNLR 385

  Fly   217 PICLLDAEFPLQD-LNLQISGWDPTKSSQTLITS----TVKERNPADCLNRYPSFR---SASQVC 273
            |:||.:...|..| ....||||..|..:.::.||    :|...:.|.| |..|.:.   |.:.:|
 Frog   386 PVCLPNVGMPWADGQPCWISGWGTTSEAGSISTSLKAASVPIISSATC-NLAPVYGGVISPTMIC 449

  Fly   274 AGGQRKG-DTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIKA 337
            ||....| |||.|.||.|::    :..:...:|.|..|:|.. |..|..||||..|..|.|||.:
 Frog   450 AGYLGGGTDTCQGDSGGPLV----TKTNSLWWLVGDTSWGYG-CARAYKPGVYGNITVFLEWIYS 509

  Fly   338 NL 339
            .:
 Frog   510 QM 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 76/247 (31%)
Tryp_SPc 108..335 CDD:214473 74/244 (30%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 2/3 (67%)
Tryp_SPc 277..510 CDD:238113 76/249 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.